PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.04G017400.3.p
Common NameGLYMA_04G017400, LOC100790922
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family Nin-like
Protein Properties Length: 908aa    MW: 100693 Da    PI: 5.9215
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.04G017400.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.8e-29591642152
               RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                          aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  Glyma.04G017400.3.p 591 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 642
                          589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.803581662IPR003035RWP-RK domain
PfamPF020426.4E-25594642IPR003035RWP-RK domain
SuperFamilySSF542771.08E-23813898No hitNo description
PROSITE profilePS5174527.102813896IPR000270PB1 domain
SMARTSM006662.8E-25813896IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2402.2E-22813893No hitNo description
CDDcd064073.49E-43814895No hitNo description
PfamPF005648.7E-19814895IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 908 aa     Download sequence    Send to blast
MGDSGVTSSA ATMMEAPPPD GTTTTATSMD FDYMGEFFLD GCWLEASADV SDFLLQSPSF  60
SNPLFDPSLS WPALETNHNK SQDAAFGTQQ ESHNNIVSVV AGGGYSQQFQ SETHSVEGVS  120
EGVRRWWFAP SPIPSPGPGP SIMEKLIRAL MWIKDYNRNK DMLIQIWVPI HKEGRPILAA  180
DDLLFSLESK SLNLAKYREI SVTYEFSAEE SDSKELARGL PGRVFRYKVP EWTPDVRFFR  240
SDEYPRVDHA QEYDVRGTVA VPIFEQGSKT CLGVIEVVMT TQQINYGPEL ESVCKALEAV  300
DLRSSKQLSI QNVKACNRTY EAALPEIYEV LRSACEMHRL PLAQTWVPCV QQGKEGCRHS  360
EDNYLLCISP VEHACYVGDP SIRSFHEACT EHHLLKGEGV AGGAFMTNQP CFSDDITSLS  420
KKDYPLSHYA RLFGLHAAVA IRLRSIYNST DDFVLEFFLP VDCNDSEEQR KMLTALSIII  480
QRVCRSLRVI RDKELEEANL SVDEVIALAD SGFARNAIFS EPQYKGMVAS LDAEEKSSET  540
MGRKFSDLRQ QQESPILKGN LDCVKECSTS VEGNLSSLGT NKTGERRRAK AEKTITLQVL  600
RQYFAGSLKD AAKNIGVCTT TLKRICRQHG IKRWPSRKIK KVGHSLQKLQ LVINSVQGAS  660
GAFQIGSFYS NFPDLASPNL SGTGFFSTLN QSDYPNSTST QPDHGSLSPE GASKSPSSSC  720
SQSSISSHSC SSMSELQQHR TANGAGNKVS TTVSEDSAGV VLKRISSEAE LKSLSQDRAK  780
LLPRSQSQET LGEHPKTQYQ QPLLKTSSSK VDSHRVKVAY GDEKTRFRMP KSWGYEDLLQ  840
EIARRFNVSD MSKFDVKYLD DDCEWVLLTC DADLEECIDV CQSSESGTIK LSLQPSSHSM  900
RSSLEFR*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.283390.0root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353870.0AC235387.1 Glycine max strain Williams 82 clone GM_WBb0115J10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014629895.10.0PREDICTED: protein NLP4-like isoform X2
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLK7KHM80.0K7KHM8_SOYBN; Uncharacterized protein
STRINGGLYMA04G01910.20.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein